PDB entry 1mnm

View 1mnm on RCSB PDB site
Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure
Deposited on 1997-11-03, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.24
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1mnma_
  • Chain 'B':
    Domains in SCOP 1.55: d1mnmb_
  • Chain 'C':
    Domains in SCOP 1.55: d1mnmc_
  • Chain 'D':
    Domains in SCOP 1.55: d1mnmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnmA (A:)
    qkerrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvlllvvsetglvytfst
    pkfepivtqqegrnliqaclnapdd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnmB (B:)
    rrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvlllvvsetglvytfstpkf
    epivtqqegrnliqaclnapd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnmC (C:)
    glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
    riqiknwvsnrrrkekt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnmD (D:)
    glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
    riqiknwvsnrrrkekt