PDB entry 1mni

View 1mni on RCSB PDB site
Description: alteration of axial coordination by protein engineering in myoglobin. bis-imidazole ligation in the his64-->val(slash)val68-->his double mutant
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-01-11, released 1995-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (63)
      • conflict (67)
    Domains in SCOPe 2.07: d1mnia_
  • Chain 'B':
    Compound: Myoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (63)
      • conflict (67)
    Domains in SCOPe 2.07: d1mnib_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mniA (A:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkvgnthltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mniB (B:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkvgnthltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg