PDB entry 1mng

View 1mng on RCSB PDB site
Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Class: oxidoreductase(superoxide acceptor)
Keywords: oxidoreductase(superoxide acceptor)
Deposited on 1994-07-13, released 1994-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnga1, d1mnga2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mngb1, d1mngb2
  • Heterogens: MN, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mngA (A:)
    pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
    hlaalpqdiqtavrnnggghlnhslfwrlltpggakepvgelkkaideqfggfqalkekl
    tqaamgrfgsgwawlvkdpfgklhvlstpnqdnpvmegftpivgidvwehayylkyqnrr
    adylqaiwnvlnwdvaeeffkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mngB (B:)
    pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
    hlaalpqdiqtavrnnggghlnhslfwrlltpggakepvgelkkaideqfggfqalkekl
    tqaamgrfgsgwawlvkdpfgklhvlstpnqdnpvmegftpivgidvwehayylkyqnrr
    adylqaiwnvlnwdvaeeffkka