PDB entry 1mnf

View 1mnf on RCSB PDB site
Description: Domain motions in GroEL upon binding of an oligopeptide
Class: chaperone
Keywords: groEL, forced unfolding, domain motions, opposite allosteric, chaperone
Deposited on 2002-09-05, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain '2':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'A':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfa1, d1mnfa2, d1mnfa3
  • Chain 'B':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfb1, d1mnfb2, d1mnfb3
  • Chain 'C':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfc1, d1mnfc2, d1mnfc3
  • Chain 'D':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfd1, d1mnfd2, d1mnfd3
  • Chain 'E':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfe1, d1mnfe2, d1mnfe3
  • Chain 'F':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnff1, d1mnff2, d1mnff3
  • Chain 'G':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfg1, d1mnfg2, d1mnfg3
  • Chain 'H':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfh1, d1mnfh2, d1mnfh3
  • Chain 'I':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfi1, d1mnfi2, d1mnfi3
  • Chain 'J':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfj1, d1mnfj2, d1mnfj3
  • Chain 'K':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfk1, d1mnfk2, d1mnfk3
  • Chain 'L':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfl1, d1mnfl2, d1mnfl3
  • Chain 'M':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfm1, d1mnfm2, d1mnfm3
  • Chain 'N':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnfn1, d1mnfn2, d1mnfn3
  • Chain 'O':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'P':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'Q':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'R':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'S':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'T':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'U':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'V':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'W':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'X':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'Y':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Chain 'Z':
    Compound: 12-residue peptide substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MNF (0-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mnfA (A:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfA (A:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mnfB (B:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfB (B:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mnfC (C:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfC (C:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mnfD (D:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfD (D:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mnfE (E:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfE (E:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mnfF (F:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfF (F:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mnfG (G:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfG (G:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mnfH (H:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfH (H:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1mnfI (I:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfI (I:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1mnfJ (J:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfJ (J:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1mnfK (K:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfK (K:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mnfL (L:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfL (L:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1mnfM (M:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfM (M:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1mnfN (N:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnfN (N:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.