PDB entry 1mnd

View 1mnd on RCSB PDB site
Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-alf4
Class: contractile protein
Keywords: ATPase, myosin, coiled coil, actin-binding, ATP-binding, heptad repeat pattern, methylation, alkylation, phosphorylation, contractile protein
Deposited on 1995-04-15, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.242
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799
      • conflict (41)
      • conflict (311)
      • conflict (320-321)
      • conflict (442)
      • conflict (445)
    Domains in SCOPe 2.07: d1mnda1, d1mnda2
  • Heterogens: MG, ALF, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mndA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mndA (A:)
    npihdrtsdyhkylkvkqtvsdkryiwynpdpderdsyecgeivsetsdsftfktvqdrq
    vkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvavnpfkr
    ipiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagktentkk
    viqylasvagvleqqilqanpileafgnakttrnnnssrfgkfieiqfnnagfisgasiq
    sylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgcvdikgvs
    dedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdktalnaas
    tvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflwlvkkinn
    vlcsraayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmdsqatidlidgrqp
    pgilalldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiq
    dwleknkdplqqdlelcfkdssdnvvtklfndpniasrfitvaaqykeqlaslmatlett
    nphfvrciipnnkqlpakledkvvldqlrcngvleiritrk