PDB entry 1mnc

View 1mnc on RCSB PDB site
Description: structure of human neutrophil collagenase reveals large s1' specificity pocket
Class: hydrolase (metalloprotease)
Keywords: hydrolase (metalloprotease)
Deposited on 1994-01-12, released 1995-02-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22894
      • conflict (4)
      • conflict (49)
      • conflict (69)
    Domains in SCOPe 2.05: d1mnca_
  • Heterogens: ZN, CA, PLH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mncA (A:)
    ltpggpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftgisqgeadini
    afyqrdhgdgspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefg
    hslglahssdpgalmypnyafretsnyslpqddidgiqaiygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mncA (A:)
    gpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftgisqgeadiniafyq
    rdhgdgspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg