PDB entry 1mnc

View 1mnc on RCSB PDB site
Description: structure of human neutrophil collagenase reveals large s1' specificity pocket
Deposited on 1994-01-12, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mnc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mnc_ (-)
gpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftgisqgeadiniafyq
rdhgdgspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg