PDB entry 1mna

View 1mna on RCSB PDB site
Description: Thioesterase Domain of Picromycin Polyketide Synthase (PICS TE), pH 8.0
Class: transferase
Keywords: thioesterase, polyketide synthase, open substrate channel, alpha-beta hydrolase, TRANSFERASE
Deposited on 2002-09-05, released 2003-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.236
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyketide synthase IV
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: picAIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mnaa_
  • Chain 'B':
    Compound: polyketide synthase IV
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Gene: picAIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mnab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mnaA (A:)
    sgadtgagagmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllagg
    ptdraegravlvgctgtaanggpheflrlstsfqeerdflavplpgygtgtgtgtallpa
    dldtaldaqarailraagdapvvllghsggallahelafrlerahgappagivlvdpypp
    ghqepievwsrqlgeglfagelepmsdarllamgryarflagprpgrssapvllvrasep
    lgdwqeergdwrahwdlphtvadvpgdhftmmrdhapavaeavlswldaiegiegagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnaA (A:)
    agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdraegr
    avlvgctgtaanggpheflrlstsfqeerdflavplpgyggtallpadldtaldaqarai
    lraagdapvvllghsggallahelafrlerahgappagivlvdpyppghqepievwsrql
    geglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergdwra
    hwdlphtvadvpgdhftmmrdhapavaeavlswlda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mnaB (B:)
    sgadtgagagmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllagg
    ptdraegravlvgctgtaanggpheflrlstsfqeerdflavplpgygtgtgtgtallpa
    dldtaldaqarailraagdapvvllghsggallahelafrlerahgappagivlvdpypp
    ghqepievwsrqlgeglfagelepmsdarllamgryarflagprpgrssapvllvrasep
    lgdwqeergdwrahwdlphtvadvpgdhftmmrdhapavaeavlswldaiegiegagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnaB (B:)
    agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdraegr
    avlvgctgtaanggpheflrlstsfqeerdflavplpgyggtallpadldtaldaqarai
    lraagdapvvllghsggallahelafrlerahgappagivlvdpyppghqepievwsrql
    geglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergdwra
    hwdlphtvadvpgdhftmmrdhapavaeavlswldaie