PDB entry 1mn9

View 1mn9 on RCSB PDB site
Description: NDP kinase mutant (H122G) complex with RTP
Class: transferase
Keywords: NDP kinase-Ribavirin complex, transferase
Deposited on 2002-09-05, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NDP kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1mn9a_
  • Chain 'B':
    Compound: NDP kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1mn9b_
  • Chain 'C':
    Compound: NDP kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1mn9c_
  • Heterogens: MG, RTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mn9A (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mn9A (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mn9B (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mn9B (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mn9C (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mn9C (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye