PDB entry 1mn3

View 1mn3 on RCSB PDB site
Description: cue domain of yeast vps9p
Deposited on 2002-09-04, released 2003-06-10
The last revision prior to the SCOP 1.67 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.244
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mn3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mn3A (A:)
    sslikkieenerkdtlntlqnmfpdmdpsliedvciakksriepcvdallslse