PDB entry 1mn1

View 1mn1 on RCSB PDB site
Description: manganese peroxidase substrate binding site mutant d179n
Class: peroxidase
Keywords: peroxidase, donor: h2o2 oxidoreductase, heme enzyme
Deposited on 1997-04-26, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Gene: MNP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02567 (0-356)
      • conflict (178)
    Domains in SCOPe 2.07: d1mn1a_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mn1A (A:)
    avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
    ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
    prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvarank
    vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
    sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
    gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa