PDB entry 1mn0

View 1mn0 on RCSB PDB site
Description: Crystal structure of galactose mutarotase from lactococcus lactis complexed with D-xylose
Class: isomerase
Keywords: epimerase, sugar binding, galactosemia, ISOMERASE
Deposited on 2002-09-04, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose 1-epimerase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: GALM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZB17 (Start-338)
      • engineered (1)
      • expression tag (339)
    Domains in SCOPe 2.07: d1mn0a1, d1mn0a2
  • Chain 'B':
    Compound: aldose 1-epimerase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: GALM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZB17 (Start-338)
      • engineered (1)
      • expression tag (339-346)
    Domains in SCOPe 2.07: d1mn0b1, d1mn0b2
  • Heterogens: XYS, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mn0A (A:)
    msikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekday
    pgatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqv
    kfslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdas
    esvenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvk
    gidhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhgg
    itfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mn0A (A:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfecqvspgseqipelgdislkagekyqattiyslhtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mn0B (B:)
    msikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekday
    pgatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqv
    kfslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdas
    esvenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvk
    gidhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhgg
    itfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mn0B (B:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh