PDB entry 1mmx

View 1mmx on RCSB PDB site
Description: Crystal structure of galactose mutarotase from Lactococcus lactis complexed with D-fucose
Class: isomerase
Keywords: epimerase, sugar binding, galactosemia, ISOMERASE
Deposited on 2002-09-04, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose 1-epimerase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: GALM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZB17 (Start-338)
      • engineered (1)
      • expression tag (339)
    Domains in SCOPe 2.07: d1mmxa1, d1mmxa2
  • Chain 'B':
    Compound: aldose 1-epimerase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: GALM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZB17 (Start-338)
      • engineered (1)
      • expression tag (339-346)
    Domains in SCOPe 2.07: d1mmxb1, d1mmxb2
  • Heterogens: FUC, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mmxA (A:)
    msikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekday
    pgatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqv
    kfslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdas
    esvenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvk
    gidhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhgg
    itfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmxA (A:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfecqvspgseqipelgdislkagekyqattiyslhtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mmxB (B:)
    msikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekday
    pgatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqv
    kfslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdas
    esvenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvk
    gidhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhgg
    itfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmxB (B:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh