PDB entry 1mms

View 1mms on RCSB PDB site
Description: Crystal structure of the ribosomal PROTEIN L11-RNA complex
Class: ribosome
Keywords: RNA-protein complex, RNA, ribosome, translocation, thiostrepton
Deposited on 1999-04-14, released 2000-04-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribosomal protein l11)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mmsa1, d1mmsa2
  • Chain 'B':
    Compound: protein (ribosomal protein l11)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mmsb_
  • Chain 'C':
    Compound: 23S ribosomal RNA
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 23S ribosomal RNA
    Species: synthetic, synthetic
  • Heterogens: CD, MG, MMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mmsA (A:)
    akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
    edksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansl
    eaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmsA (A:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mmsB (B:)
    akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
    edksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansl
    eaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmsB (B:)
    ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
    taksmgievv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.