PDB entry 1mmo

View 1mmo on RCSB PDB site
Description:
Deposited on 1994-02-22, released 1995-02-27
The last revision prior to the SCOP 1.71 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mmob_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mmoc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mmod_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mmoe_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mmog_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mmoh_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoB (B:)
    errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
    gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
    gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
    kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
    fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
    dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
    dyasaidfkadrdqivkavlaglk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoC (C:)
    errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
    gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
    gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
    kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
    fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
    dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
    dyasaidfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoD (D:)
    aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
    derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
    ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
    gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
    vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
    giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
    nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
    tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
    liaqphvrgdklwtlddikrlncvfknpvkaf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoE (E:)
    aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
    derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
    ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
    gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
    vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
    giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
    nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
    tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
    liaqphvrgdklwtlddikrlncvfknpvkaf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoG (G:)
    lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoH (H:)
    lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh