PDB entry 1mml

View 1mml on RCSB PDB site
Description: mechanistic implications from the structure of a catalytic fragment of mmlv reverse transcriptase
Deposited on 1995-07-18, released 1995-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1mml__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mml_ (-)
    lhetskepdvslgstwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqe
    arlgikphiqrlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptv
    pnpynllsglppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlp
    qgfknsptlfdealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgn
    lgyrasakkaqicqkqvkylgyllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mml_ (-)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllk