PDB entry 1mmj

View 1mmj on RCSB PDB site
Description: Porcine pancreatic elastase complexed with a potent peptidyl inhibitor, FR136706
Class: hydrolase
Keywords: chymotrypsin family, HYDROLASE
Deposited on 2002-09-04, released 2002-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: Elastase 1
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mmjn_
  • Heterogens: SO4, CA, FR1, HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmjN (N:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn