PDB entry 1mmi

View 1mmi on RCSB PDB site
Description: e. coli dna polymerase beta subunit
Deposited on 2002-09-04, released 2003-09-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-04, with a file datestamp of 2003-09-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmiA (A:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmiB (B:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl