PDB entry 1mmg

View 1mmg on RCSB PDB site
Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain
Class: coiled coil
Keywords: coiled coil, myosin, dictyostelium, motor, nucleotide analogues, atpgs, ATPase, actin-binding
Deposited on 1997-07-18, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-758)
      • conflict (64)
      • conflict (272)
      • conflict (311)
      • conflict (320-321)
      • conflict (442)
      • conflict (488)
      • conflict (627)
      • conflict (683)
      • conflict (706)
      • conflict (736)
    Domains in SCOPe 2.07: d1mmga1, d1mmga2
  • Heterogens: MG, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mmgA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktsdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqstternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfltvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvleairitrkgfpnriiyadfvkryydlapnvprdaedsq
    katdavlkhlnidpeqfrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmgA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktsdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrngvleqqilqanpileafgnakttrnnnssrfgkfieiq
    fnnagfisgasiqsylleksrvvfqstternyhifyqllagataeekkalhlagpesfny
    lnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgageg
    avlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkaly
    grlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhm
    fkveqeeylkekinldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfsk
    knakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfn
    dpniasrafltvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrc
    ngvleairitrkgfpnriiyadfvkryydlapnvprdaedsqkatdavlkhlnidpeqfr
    fgitkiffragqlarieeare