PDB entry 1mmd

View 1mmd on RCSB PDB site
Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-bef3
Class: contractile protein
Keywords: ATPase, myosin, coiled coil, actin-binding, ATP-binding, heptad repeat pattern, methylation, alkylation, phosphorylation, contractile protein
Deposited on 1995-03-21, released 1996-08-17
The last revision prior to the SCOP 1.75 freeze date was dated 1996-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-758)
      • conflict (41)
      • conflict (311)
      • conflict (320-321)
      • conflict (442)
      • conflict (445)
      • conflict (488)
    Domains in SCOP 1.75: d1mmda1, d1mmda2
  • Heterogens: MG, ADP, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mmdA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmdA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqagvleqqilqanpileafgnakttrnnnssrfgkfie
    iqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesf
    nylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgag
    egavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvka
    lygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlcinytneklqqffnh
    hmfkveqeeylkekinldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshf
    skknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtkl
    fndpniasrafitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldql
    rcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlnidpeq
    yrfgitkiffragqlarieeare