PDB entry 1mmc

View 1mmc on RCSB PDB site
Description: 1h nmr study of the solution structure of ac-amp2
Deposited on 1995-10-25, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mmc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmc_ (-)
    vgecvrgrcpsgmccsqfgycgkgpkycgr