PDB entry 1mma

View 1mma on RCSB PDB site
Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain
Class: coiled coil
Keywords: coiled coil, myosin, dictyostelium, motor, nucleotide analogues, ADP, ATPase, actin-binding
Deposited on 1997-07-18, released 1997-12-03
The last revision prior to the SCOP 1.75 freeze date was dated 1997-12-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-758)
      • conflict (64)
      • conflict (311)
      • conflict (736)
    Domains in SCOP 1.75: d1mmaa1, d1mmaa2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mmaA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktsdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqfrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmaA (A:)
    npihdrtsdyhkylkvkqgdsddkryiwynpdpkerdsyecgeivsetsdsftfktsdgq
    drqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvavnp
    fkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagkten
    tkkviqylasvagrnqgvleqqilqanpileafgnakttrnnnssrfgkfieiqfnnagf
    isgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgc
    vdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdk
    talnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflw
    lvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfkleqe
    eylkeidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskknaky
    eeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfndpnia
    sranfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcngvl
    egiritrkgfpnriiyadfqkatdavlkhlnidpeqfrfgitkiffragqlarieeare