PDB entry 1mma

View 1mma on RCSB PDB site
Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain
Deposited on 1997-07-18, released 1997-12-03
The last revision prior to the SCOP 1.59 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mma_ (-)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktsdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfgk
    fieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagp
    esfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfek
    gagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdal
    vkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqf
    fnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdn
    tlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfk
    dssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnk
    qlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqk
    atdavlkhlnidpeqfrfgitkiffragqlarieeare
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mma_ (-)
    npihdrtsdyhkylkvkqgdsddkryiwynpdpkerdsyecgeivsetsdsftfktsdgq
    drqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvavnp
    fkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagkten
    tkkviqylasvagrnqgvleqqilqanpileafgnakttrnnnssrfgkfieiqfnnagf
    isgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgc
    vdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdk
    talnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflw
    lvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfkleqe
    eylkeidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskknaky
    eeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfndpnia
    sranfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcngvl
    egiritrkgfpnriiyadfqkatdavlkhlnidpeqfrfgitkiffragqlarieeare