PDB entry 1mm4

View 1mm4 on RCSB PDB site
Description: Solution NMR structure of the outer membrane enzyme PagP in DPC micelles
Class: transferase
Keywords: beta barrel, Palmitoyltransferase
Deposited on 2002-09-03, released 2002-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CrcA protein
    Species: Escherichia coli [TaxId:562]
    Gene: CrcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37001 (1-161)
      • expression tag (0)
      • expression tag (162-169)
    Domains in SCOPe 2.07: d1mm4a1, d1mm4a2, d1mm4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mm4A (A:)
    mnadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsr
    wdekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwny
    iplpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqflehhhhhh