PDB entry 1mm3

View 1mm3 on RCSB PDB site
Description: solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
Deposited on 2002-09-02, released 2003-07-22
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-22, with a file datestamp of 2003-07-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mm3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mm3A (A:)
    gplgsdhhmefcrvckdggellccdtcpssyhihclrpalyevpdgewqcprctcpalkg
    k