PDB entry 1mm0

View 1mm0 on RCSB PDB site
Description: solution structure of termicin, an antimicrobial peptide from the termite pseudacanthotermes spiniger
Deposited on 2002-09-02, released 2003-05-13
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mm0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mm0A (A:)
    acnfqscwatcqaqhsiyfrrafcdrsqckcvfvrg