PDB entry 1mm0

View 1mm0 on RCSB PDB site
Description: Solution structure of termicin, an antimicrobial peptide from the termite Pseudacanthotermes spiniger
Class: antimicrobial protein
Keywords: Termite, Cytein-rich, Antimicrobial peptide, Insect defensin, CSab motif, NMR, ANTIMICROBIAL PROTEIN
Deposited on 2002-09-02, released 2003-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Termicin
    Species: Pseudacanthotermes spiniger [TaxId:115113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mm0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mm0A (A:)
    acnfqscwatcqaqhsiyfrrafcdrsqckcvfvrg