PDB entry 1mly

View 1mly on RCSB PDB site
Description: Crystal Structure of 7,8-Diaminopelargonic Acid Synthase in complex with the cis isomer of amiclenomycin
Class: transferase
Keywords: Aminotransferase, Fold type I, subclass II, amiclenomycin, TRANSFERASE
Deposited on 2002-09-02, released 2002-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-diamino-pelargonic acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: bioA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • see remark 999 (13)
    Domains in SCOPe 2.08: d1mlya_
  • Chain 'B':
    Compound: 7,8-diamino-pelargonic acid aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: bioA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • see remark 999 (13)
    Domains in SCOPe 2.08: d1mlyb_
  • Heterogens: ACZ, NA, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mlyA (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlyA (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregil
    liadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngea
    gcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrv
    lgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnrav
    qdetffc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mlyB (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlyB (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffc