PDB entry 1mlv

View 1mlv on RCSB PDB site
Description: Structure and Catalytic Mechanism of a SET Domain Protein Methyltransferase
Class: transferase
Keywords: SET Domain, Lysine N-Methylation, Photosynthesis, Post-translational Modification
Deposited on 2002-08-30, released 2002-10-30
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose-1,5 biphosphate carboxylase/oxygenase large subunit N-methyltransferase
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-441)
    Domains in SCOP 1.75: d1mlva1, d1mlva2
  • Chain 'B':
    Compound: Ribulose-1,5 biphosphate carboxylase/oxygenase large subunit N-methyltransferase
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-443)
    Domains in SCOP 1.75: d1mlvb1, d1mlvb2
  • Chain 'C':
    Compound: Ribulose-1,5 biphosphate carboxylase/oxygenase large subunit N-methyltransferase
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43088 (Start-437)
      • engineered (438-442)
    Domains in SCOP 1.75: d1mlvc1, d1mlvc2
  • Heterogens: SAH, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mlvA (A:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlvA (A:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlnl
    vvvpmadlinhsagvttedhayevylfslksplsvkageqvyiqydlnksnaelaldygf
    iepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlv
    alggtdaflleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelk
    egnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
    enly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mlvB (B:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlvB (B:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mlvC (C:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlvC (C:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
    enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
    nksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynr
    tlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksala
    gyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrl
    kdlglcgengdilenlyf