PDB entry 1mlv

View 1mlv on RCSB PDB site
Description: structure and catalytic mechanism of a set domain protein methyltransferase
Deposited on 2002-08-30, released 2002-10-30
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mlvA (A:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlvA (A:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlnl
    vvvpmadlinhsagvttedhayevylfslksplsvkageqvyiqydlnksnaelaldygf
    iepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlv
    alggtdaflleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelk
    egnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
    enly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mlvB (B:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlvB (B:)
    slspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpd
    avaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqel
    qgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlr
    nenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqyd
    lnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifyn
    rtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksal
    agyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerr
    lkdlglcgengdilenlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mlvC (C:)
    mtepslspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlw
    inpdavaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseee
    lqelqgsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsraf
    srlrnenlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvy
    iqydlnksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfd
    ifynrtlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreac
    ksalagyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyy
    qerrlkdlglcgengdilenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mlvC (C:)
    lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
    vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
    gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
    enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
    nksnaelaldygfiepnenrhaytltleisesdpffddkldvaesngfaqtayfdifynr
    tlppgllpylrlvalggtdaflleslfrdtiwghlelsvsrdneellckavreacksala
    gyhttieqdrelkegnldsrlaiavgiregekmvlqqidgifeqkeleldqleyyqerrl
    kdlglcgengdilenlyf