PDB entry 1mlm

View 1mlm on RCSB PDB site
Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
Deposited on 1994-06-15, released 1994-08-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.1611
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mlm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mlm_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtiltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg