PDB entry 1mlb

View 1mlb on RCSB PDB site
Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1995-03-08, released 1995-06-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1-kappa d44.1 fab (light chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mlba1, d1mlba2
  • Chain 'B':
    Compound: igg1-kappa d44.1 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • PIR PC4202 (1-217)
      • conflict (4)
      • conflict (10)
      • conflict (25)
      • conflict (27)
      • conflict (30)
      • conflict (49)
      • conflict (56)
      • conflict (58)
      • conflict (62)
      • conflict (97-98)
      • insertion (100-103)
      • conflict (117)
      • conflict (124)
    Domains in SCOP 1.73: d1mlbb1, d1mlbb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mlbA (A:)
    dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyvsqsssgips
    rfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mlbB (B:)
    qvqlqesgaevmkpgasvkisckatgytfstywiewvkqrpghglewigeilpgsgstyy
    nekfkgkatftadtssntaymqlssltsedsavyycargdgnygywgqgttltvssastt
    ppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivprdc