PDB entry 1mlb

View 1mlb on RCSB PDB site
Description:
Deposited on 1995-03-08, released 1995-06-03
The last revision prior to the SCOP 1.65 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mlba1, d1mlba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mlbb1, d1mlbb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mlbA (A:)
    dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyvsqsssgips
    rfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mlbB (B:)
    qvqlqesgaevmkpgasvkisckatgytfstywiewvkqrpghglewigeilpgsgstyy
    nekfkgkatftadtssntaymqlssltsedsavyycargdgnygywgqgttltvssastt
    ppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivprdc