PDB entry 1ml6

View 1ml6 on RCSB PDB site
Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide
Class: transferase
Keywords: GST detoxification, crystal structure, mGSTA2-2, TRANSFERASE
Deposited on 2002-08-30, released 2003-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-Transferase GT41A
    Species: Mus musculus [TaxId:10090]
    Gene: GST
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10648
      • modified residue (110)
    Domains in SCOPe 2.07: d1ml6a1, d1ml6a2
  • Chain 'B':
    Compound: Glutathione S-Transferase GT41A
    Species: Mus musculus [TaxId:10090]
    Gene: GST
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10648 (Start-220)
      • modified residue (110)
    Domains in SCOPe 2.07: d1ml6b1, d1ml6b2
  • Heterogens: GBX, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ml6A (A:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklvqtrailnyiatkydlygkdmkeralidmytegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdvhllelllyveeldaslltpfpll
    kafksrisslpnvkkflqpgsqrkppldakqieearkvfkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml6A (A:)
    gkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveidg
    mklvqtrailnyiatkydlygkdmkeralidmytegildltemigqlvlcppdqreakta
    lakdrtknrylpafekvlkshgqdylvgnrltrvdvhllelllyveeldaslltpfpllk
    afksrisslpnvkkflqpgsqrkppldakqieearkvfkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ml6B (B:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklvqtrailnyiatkydlygkdmkeralidmytegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdvhllelllyveeldaslltpfpll
    kafksrisslpnvkkflqpgsqrkppldakqieearkvfkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml6B (B:)
    gkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveidg
    mklvqtrailnyiatkydlygkdmkeralidmytegildltemigqlvlcppdqreakta
    lakdrtknrylpafekvlkshgqdylvgnrltrvdvhllelllyveeldaslltpfpllk
    afksrisslpnvkkflqpgsqrkppldakqieearkvfkf