PDB entry 1ml5

View 1ml5 on RCSB PDB site
Description: Structure of the E. coli ribosomal termination complex with release factor 2
Deposited on 2002-08-30, released 2003-01-14
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ml5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ml5b_
  • Chain 'C':
    Domains in SCOP 1.71: d1ml5c_
  • Chain 'E':
    Domains in SCOP 1.71: d1ml5e_
  • Chain 'F':
    Domains in SCOP 1.71: d1ml5f_
  • Chain 'G':
    Domains in SCOP 1.71: d1ml5g_
  • Chain 'H':
    Domains in SCOP 1.71: d1ml5h_
  • Chain 'I':
    Domains in SCOP 1.71: d1ml5i_
  • Chain 'J':
    Domains in SCOP 1.71: d1ml5j_
  • Chain 'K':
    Domains in SCOP 1.71: d1ml5k_
  • Chain 'L':
    Domains in SCOP 1.71: d1ml5l_
  • Chain 'M':
    Domains in SCOP 1.71: d1ml5m_
  • Chain 'N':
    Domains in SCOP 1.71: d1ml5n_
  • Chain 'O':
    Domains in SCOP 1.71: d1ml5o_
  • Chain 'P':
    Domains in SCOP 1.71: d1ml5p_
  • Chain 'Q':
    Domains in SCOP 1.71: d1ml5q_
  • Chain 'R':
    Domains in SCOP 1.71: d1ml5r_
  • Chain 'S':
    Domains in SCOP 1.71: d1ml5s_
  • Chain 'T':
    Domains in SCOP 1.71: d1ml5t_
  • Chain 'U':
    Domains in SCOP 1.71: d1ml5u_
  • Chain 'V':
    Domains in SCOP 1.71: d1ml5v_
  • Chain 'W':
    Domains in SCOP 1.71: d1ml5w_
  • Chain 'X':
    Domains in SCOP 1.71: d1ml5x_
  • Chain 'Z':
    Domains in SCOP 1.71: d1ml5z_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ml5E (E:)
    mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
    lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
    lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
    fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    eaeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5E (E:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ml5F (F:)
    mgnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdiera
    adnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrv
    aeqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlra
    nidygfalarttygvlgvkayiflgeviggqkpkarpelpkaeerprrrrpavrvkkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5F (F:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ml5G (G:)
    mgryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlre
    kqklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarql
    vrhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldveg
    mkgkflrlpdredlalpvqenlviefysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5G (G:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvqenlviefysr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ml5H (H:)
    mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
    yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
    kelgsrnpiniayatmealrqlrtkadverlrkgeahaqaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5H (H:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ml5I (I:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ml5J (J:)
    marrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplk
    vfkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavri
    ahelmdaaegkggavkkkedvermaeanrayahyrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5J (J:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ml5K (K:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ml5L (L:)
    meqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfd
    ayitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkar
    rapqyskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5L (L:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ml5M (M:)
    mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
    ehfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5M (M:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ml5N (N:)
    makkpskkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpya
    aqlaaldaakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcr
    pkkkfrkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5N (N:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ml5O (O:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5O (O:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ml5P (P:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5P (P:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1ml5Q (Q:)
    markaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkas
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5Q (Q:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1ml5R (R:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgirg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5R (R:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1ml5S (S:)
    mvkirlarfgskhnphyphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverar
    ywlsvgaqptdtarrllrqagvfrqearega
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5S (S:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1ml5T (T:)
    mpkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveii
    esrpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5T (T:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1ml5U (U:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5U (U:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1ml5V (V:)
    mprslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpv
    yitenmvghklgefaptrtyrghgkeakatkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5V (V:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1ml5W (W:)
    maqkkpkrnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkae
    slidkaakgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5W (W:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ml5X (X:)
    gkgdrrtrrgkiwrgtygkyrprkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5X (X:)
    gkgdrrtrrgkiwrgtygkyrprk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1ml5Z (Z:)
    mfeinpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgker
    ssleavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfs
    geydsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvt
    ikisgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlr
    idvyrtsgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyelem
    qkknaekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieas
    lkagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml5Z (Z:)
    inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
    eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
    dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
    sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
    yrtsgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyelemqkk
    naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
    gl