PDB entry 1ml3

View 1ml3 on RCSB PDB site
Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester
Deposited on 2002-08-29, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ml3A (A:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ml3B (B:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ml3C (C:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ml3D (D:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl