PDB entry 1ml1

View 1ml1 on RCSB PDB site
Description: protein engineering with monomeric triosephosphate isomerase: the modelling and structure verification of a seven residue loop
Class: isomerase
Keywords: complex (isomerase/phosphoglycolic acid), intramolecular oxidoreductase, loop design
Deposited on 1996-09-27, released 1997-03-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • conflict (14)
      • conflict (17-18)
      • conflict (67-71)
      • conflict (73-74)
      • conflict (92)
    Domains in SCOPe 2.01: d1ml1a_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • conflict (14)
      • conflict (17-18)
      • conflict (67-71)
      • conflict (73-74)
      • conflict (92)
    Domains in SCOPe 2.01: d1ml1c_
  • Chain 'E':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • conflict (14)
      • conflict (17-18)
      • conflict (67-71)
      • conflict (73-74)
      • conflict (92)
    Domains in SCOPe 2.01: d1ml1e_
  • Chain 'G':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • conflict (14)
      • conflict (17-18)
      • conflict (67-71)
      • conflict (73-74)
      • conflict (92)
    Domains in SCOPe 2.01: d1ml1g_
  • Chain 'I':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • conflict (14)
      • conflict (17-18)
      • conflict (67-71)
      • conflict (73-74)
      • conflict (92)
    Domains in SCOPe 2.01: d1ml1i_
  • Chain 'K':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • conflict (14)
      • conflict (17-18)
      • conflict (67-71)
      • conflict (73-74)
      • conflict (92)
    Domains in SCOPe 2.01: d1ml1k_
  • Heterogens: PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ml1A (A:)
    mskpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml1A (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ml1C (C:)
    mskpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml1C (C:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ml1E (E:)
    mskpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml1E (E:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ml1G (G:)
    mskpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml1G (G:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ml1I (I:)
    mskpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml1I (I:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ml1K (K:)
    mskpqpiaaanwkcsgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ml1K (K:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
    q