PDB entry 1mku

View 1mku on RCSB PDB site
Description: carboxylic ester hydrolase, orthorhombic form of the triple mutant
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase, orthorhombic form
Deposited on 1997-09-10, released 1997-12-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: PRO-PLA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (51)
      • engineered (72)
      • engineered (98)
    Domains in SCOPe 2.05: d1mkua_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mkuA (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncfkqakklds
    ckvlvdnpytnnfsyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
    knc