PDB entry 1mku

View 1mku on RCSB PDB site
Description: carboxylic ester hydrolase, orthorhombic form of the triple mutant
Deposited on 1997-09-10, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mku__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mku_ (-)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncfkqakklds
    ckvlvdnpytnnfsyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
    knc