PDB entry 1mks

View 1mks on RCSB PDB site
Description: carboxylic ester hydrolase, trigonal form of the triple mutant
Deposited on 1997-08-27, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mks__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mks_ (-)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncfkqakklds
    ckvlvdnpytnnfsyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
    knc