PDB entry 1mkr

View 1mkr on RCSB PDB site
Description: Crystal Structure of a Mutant Variant of Cytochrome c Peroxidase (Plate like crystals)
Deposited on 2002-08-29, released 2003-04-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1mkra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mkrA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawytsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl