PDB entry 1mkr

View 1mkr on RCSB PDB site
Description: Crystal Structure of a Mutant Variant of Cytochrome c Peroxidase (Plate like crystals)
Class: oxidoreductase
Keywords: cytochrome c peroxidase, crystal structure, oxygen radical, Trp cation radical, Trp-Tyr covalent cross-link, OXIDOREDUCTASE
Deposited on 2002-08-29, released 2003-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: OPBYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (51)
    Domains in SCOPe 2.08: d1mkra_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkrA (A:)
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawytsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl