PDB entry 1mkq

View 1mkq on RCSB PDB site
Description: Crystal Structure of the Mutant Variant of Cytochrome c Peroxidase in the 'Open' Uncross-linked form
Class: oxidoreductase
Keywords: Tryptophan-Tyrosine Cross-Link, Trp Cation Radical, Cytochrome c Peroxidase, crystal structure, oxygen radical, OXIDOREDUCTASE
Deposited on 2002-08-29, released 2003-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.184
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c peroxidase
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: OPBYC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00431 (0-293)
    • engineered (51)
  Domains in SCOPe 2.05: d1mkqa_
• Heterogens: HEM, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mkqA (A:)
  ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawytsgtwdkh
  dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
  gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
  hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
  dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl