PDB entry 1mkp

View 1mkp on RCSB PDB site
Description: crystal structure of pyst1 (mkp3)
Class: hydrolase
Keywords: hydrolase
Deposited on 1998-07-11, released 1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyst1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16828 (1-143)
      • engineered (89)
    Domains in SCOPe 2.08: d1mkpa_
  • Heterogens: CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkpA (A:)
asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh
wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv
kmkksnispnfnfmgqlldfertl