PDB entry 1mkm

View 1mkm on RCSB PDB site
Description: crystal structure of the thermotoga maritima iclr
Class: transcription
Keywords: STRUCTURAL GENOMICS, WINGED HELIX-TURN-HELIX, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2002-08-29, released 2002-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IclR transcriptional regulator
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mkma1, d1mkma2
  • Chain 'B':
    Compound: IclR transcriptional regulator
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXS0 (3-248)
      • cloning artifact (2)
    Domains in SCOPe 2.05: d1mkmb1, d1mkmb2
  • Heterogens: ZN, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mkmA (A:)
    gshmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkr
    yvpgyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqs
    ipmvsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelek
    irkrgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkeka
    eeisrklgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkmA (A:)
    mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvp
    gyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipm
    vsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelekirk
    rgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeei
    srklgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mkmB (B:)
    gshmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkr
    yvpgyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqs
    ipmvsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelek
    irkrgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkeka
    eeisrklgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkmB (B:)
    hmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryv
    pgyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsip
    mvsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelekir
    krgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaee
    isrklgy