PDB entry 1mkm

View 1mkm on RCSB PDB site
Description: crystal structure of the thermotoga maritima iclr
Deposited on 2002-08-29, released 2002-09-11
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-11, with a file datestamp of 2002-09-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mkmA (A:)
    gshmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkr
    yvpgyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqs
    ipmvsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelek
    irkrgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkeka
    eeisrklgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkmA (A:)
    mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvp
    gyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipm
    vsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelekirk
    rgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeei
    srklgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mkmB (B:)
    gshmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkr
    yvpgyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqs
    ipmvsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelek
    irkrgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkeka
    eeisrklgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkmB (B:)
    hmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryv
    pgyklieygsfvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsip
    mvsrlgmkvdlystasgksilafvpekelkeylkivelkpktpntitnprvlkrelekir
    krgyavdneeneigimcvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaee
    isrklgy