PDB entry 1mke

View 1mke on RCSB PDB site
Description: Structure of the N-WASP EVH1 Domain-WIP complex
Class: protein binding
Keywords: polyproline, protein-protein complex, NMR, PROTEIN BINDING
Deposited on 2002-08-29, released 2002-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion protein consisting of Wiskott-Aldrich syndrome protein interacting protein (WIP), GSGSG linker, and Neural Wiskott-Aldrich syndrome protein (N-WASP)
    Species: Rattus norvegicus, Homo sapiens [TaxId:10116,9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43516 (0-24)
      • linker (25-29)
    • Uniprot O08816 (30-End)
    Domains in SCOPe 2.06: d1mkea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1mkeA (A:)
dlpppepyvqttksypsklarnesrgsgsgslfsflgkkcvtmssavvqlyaadrncmws
kkcsgvaclvkdnpqrsyflrifdikdgkllweqelynnfvynsprgyfhtfagdtcqva
lnfaneeeakkfrkavtdllgrrqrksekrrd

    Sequence, based on observed residues (ATOM records): (download) 
    >1mkeA (A:)
dlpppepyvqttksypsklarnesrgsgsgslfsflgkkcvtmssavvqlyaadrncmws
kkcsgvaclvkdnpqrsyflrifdikdgkllweqelynnfvynsprgyfhtfagdtcqva
lnfaneeeakkfrkavtdllgrrq