PDB entry 1mke

View 1mke on RCSB PDB site
Description: structure of the n-wasp evh1 domain-wip complex
Deposited on 2002-08-29, released 2002-12-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mkea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkeA (A:)
dlpppepyvqttksypsklarnesrgsgsgslfsflgkkcvtmssavvqlyaadrncmws
kkcsgvaclvkdnpqrsyflrifdikdgkllweqelynnfvynsprgyfhtfagdtcqva
lnfaneeeakkfrkavtdllgrrq