PDB entry 1mkb

View 1mkb on RCSB PDB site
Description: escherichia coli beta-hydroxydecanoyl thiol ester dehydrase at ph 5 and 21 degrees c
Class: fatty acid biosynthesis
Keywords: fatty acid biosynthesis
Deposited on 1996-01-08, released 1996-07-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-hydroxydecanoyl thiol ester dehydrase
    Species: Escherichia coli [TaxId:562]
    Gene: FABA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1mkba_
  • Chain 'B':
    Compound: beta-hydroxydecanoyl thiol ester dehydrase
    Species: Escherichia coli [TaxId:562]
    Gene: FABA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1mkbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkbA (A:)
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkbB (B:)
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf