PDB entry 1mka

View 1mka on RCSB PDB site
Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine
Class: fatty acid biosynthesis
Keywords: fatty acid biosynthesis
Deposited on 1996-01-08, released 1996-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-hydroxydecanoyl thiol ester dehydrase
    Species: Escherichia coli [TaxId:562]
    Gene: FABA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mkaa_
  • Chain 'B':
    Compound: beta-hydroxydecanoyl thiol ester dehydrase
    Species: Escherichia coli [TaxId:562]
    Gene: FABA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mkab_
  • Heterogens: DAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkaA (A:)
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mkaB (B:)
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf